PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G004700.1
Common NamePOPTR_0004s00650g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family TALE
Protein Properties Length: 370aa    MW: 41189.3 Da    PI: 6.6094
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G004700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-092963312055
                         HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Potri.004G004700.1 296 HKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 331
                         4569*****************************885 PP

2ELK38.42.7e-13251272122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK qLlrKYsgyLgsLk+EF+
  Potri.004G004700.1 251 ELKGQLLRKYSGYLGSLKKEFM 272
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.6E-19115159IPR005540KNOX1
PfamPF037905.9E-21117155IPR005540KNOX1
SMARTSM012569.2E-25164215IPR005541KNOX2
PfamPF037911.4E-20168214IPR005541KNOX2
PfamPF037892.4E-10251272IPR005539ELK domain
PROSITE profilePS5121311.034251271IPR005539ELK domain
SMARTSM011886.0E-8251272IPR005539ELK domain
PROSITE profilePS5007112.989271334IPR001356Homeobox domain
SMARTSM003897.6E-14273338IPR001356Homeobox domain
SuperFamilySSF466892.4E-19273348IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-28276336IPR009057Homeodomain-like
CDDcd000861.08E-12283335No hitNo description
PfamPF059202.5E-16291330IPR008422Homeobox KN domain
PROSITE patternPS000270309332IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MEGGGAGCSS TPSLMMAFGD SSNGLCPMMM MPLMSSSSSA HQHHHQQQHV NAGDSSISNT  60
LFLPLPPTNY QSQNRINNSA SGSSMILDDH NHNNNTVTAT GCYFMENNDG GSSSTSVKAK  120
IMAHPHYHRL LAAYANCQKV GAPPEVVARL EEACASAASM GPANTDGIGE DPALDQFMEA  180
YCEMLTKYEQ ELSKPLKEAM VFLQRVECQF RALTLSSPNS AWGEGNDRNA SSEEELDVNN  240
KFIDPQAEDQ ELKGQLLRKY SGYLGSLKKE FMKKRKKGKL PKEARQQLLD WWSRHHKWPY  300
PSESQKLALA ESTGLDQKQI NNWFINQRKR HWKPSEDMQF VVMDAGHPHY YMDNVLGNPF  360
PMDISHTLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1266275LKKEFMKKRK
2272276KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.32820.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6849370.0AY684937.1 Populus balsamifera subsp. trichocarpa x Populus deltoides homeobox transcription factor KN2 (Kn2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304900.20.0Knox protein 1
SwissprotP466081e-157HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLB9N8F40.0B9N8F4_POPTR; Knox protein 1
STRINGVIT_10s0116g00190.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-134KNOX/ELK homeobox transcription factor